PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 210aa    MW: 23807.4 Da    PI: 10.6718
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14820.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+  ++++G g W++ ++  g+ R++k+c++rw +yl
       KHN14820.1 14 KGSWTREEDQILISHIQRYGHGIWRALPKQAGLLRCGKSCRLRWINYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding55.99.7e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e++++++  lG++ W+tIa +++ gRt++++k++w+++l
       KHN14820.1  67 RGKFSKEEEEIILKLHGILGNR-WATIATRLP-GRTDNEIKNFWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129414.8961IPR017930Myb domain
SuperFamilySSF466895.43E-2810108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
CDDcd001675.13E-101661No hitNo description
PROSITE profilePS5129427.0362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2665116IPR009057Homeodomain-like
SMARTSM007177.5E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001673.81E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVRTPCCEKM GLKKGSWTRE EDQILISHIQ RYGHGIWRAL PKQAGLLRCG KSCRLRWINY  60
LSPDIKRGKF SKEEEEIILK LHGILGNRWA TIATRLPGRT DNEIKNFWHT HLKKRLERSK  120
VINTYSNPLQ EAQTASSART LISVPRVAVE ASGASSSRNP PIVGLGFYGV ASSDILGQII  180
GNSSHSRQID KELEFRSNVY MNSHHKGMKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535378.11e-156PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH49e-70MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0R0HUA71e-156A0A0R0HUA7_SOYBN; Uncharacterized protein
TrEMBLA0A0B2Q0H41e-156A0A0B2Q0H4_GLYSO; Myb-related protein Myb4
STRINGGLYMA10G30860.21e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-68myb domain protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]